Analytical Data
-
Gene name
C20orf149
- Application
-
Alternative Names
C20orf149; dJ697K14.9; Exdpf; Exocrine differentiation and proliferation factor; Pancreatic progenitor cell differentiation and proliferation factor; Pancreatic progenitor cell differentiation and proliferation factor homolog; PPDPF; PPDPF_HUMAN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9H3Y8
-
Expression Region
1-114aa
-
AA Sequence
MAAIPSSGSLVATHDYYRRRLGSTSSNSSCSSTECPGEAIPHPPGLPKADPGHWWASFFFGKSTLPFMATVLESAEHSEPPQASSSMTACGLARDAPRKQPGGQSSTASAGPPS
-
Molecular Weight
38.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C20orf149, also known as a candidate gene located on chromosome 20, has garnered interest in recent years due to its potential roles in various biological processes and diseases. Research indicates that C20orf149 may be involved in cell proliferation, differentiation, and apoptosis, which are critical for normal development and homeostasis. Its expression patterns are particularly intriguing; studies have shown that it is upregulated in certain cancers and may contribute to tumorigenesis, making it a potential biomarker for cancer diagnosis and prognosis. Furthermore, the functional characterization of C20orf149 through recombinant protein studies could elucidate its molecular mechanisms and interactions within cellular pathways. Expression of C20orf149 as a recombinant protein allows researchers to examine its properties, interactions with other proteins, and its functional significance in vitro. Understanding the biochemical characteristics and biological functions of C20orf149 could provide insights into its role in health and disease, potentially leading to novel therapeutic strategies. The ongoing exploration of C20orf149 not only enhances our comprehension of its biological importance but also invites further investigation into its implications in cancer biology and other related fields.
