Analytical Data
-
Gene name
ALTA1
- Application
-
Alternative Names
ALTA1;Major allergen Alt a 1
-
Species
E.coli
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P79085
-
Expression Region
19-157aa
-
AA Sequence
APLESRQDTASCPVTTEGDYVWKISEFYGRKPEGTYYNSLGFNIKATNGGTLDFTCSAQADKLEDHKWYSCGENSFMDFSFDSDRSGLLLKQKVSDDITYVATATLPNYCRAGGNGPKDFVCQGVADAYITLVTLPKSS
-
Molecular Weight
17.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ALTA1, a member of the ALTA family of proteins, has emerged as a focal point of research due to its potential roles in various cellular processes and its implications in disease mechanisms. Characterized by its unique structure and functional properties, ALTA1 is believed to be involved in critical biological pathways such as cell proliferation, differentiation, and apoptosis. Recent studies have suggested that ALTA1 may be linked to specific cancers and inflammatory conditions, prompting scientists to investigate its molecular mechanisms and signaling pathways. The development of recombinant ALTA1 proteins has enabled researchers to explore its biological functions in vitro and in vivo, providing valuable insights into its role in health and disease. By understanding the expression patterns and functional implications of ALTA1, researchers aim to uncover potential therapeutic targets and diagnostic markers, paving the way for innovative approaches in disease treatment. With its increasing relevance in biomedical research, the study of ALTA1 promises to enhance our understanding of complex biological systems and contribute to the advancement of personalized medicine strategies.











