Cat: PA2000-2296

Recombinant E.coli ypr-10 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ypr-10

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ypr-10;Class 10 plant pathogenesis-related Protein 2B

  • Species

    E.coli

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    D1YSM5

  • Expression Region

    1-157aa

  • AA Sequence

    MGAITYDMEIPSSISAEKMFKAFVLDGDTIIPKALPHAITGVQTLEGDGGVGTIKLTTFGEGSVHKSVKHRIDGLDKENFTYSYSIIEGGALDVFESISYHIKIVATPDGGCICKNRSIYTPKCDAQVSEEEIKAGKERASGIFKKVEAYLLANPDC

  • Molecular Weight

    32.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

YPR-10, a recombinant protein, has garnered significant attention in biochemical and pharmaceutical research due to its potential applications in various fields, including drug discovery and therapeutic development. As a member of a specific protein family, YPR-10 is believed to play a crucial role in cellular processes such as signal transduction, protein interactions, and metabolic regulation. Initial studies have indicated that YPR-10 exhibits unique structural characteristics that may enhance its functionality and stability as a recombinant product. Researchers are particularly interested in its implications for understanding disease mechanisms, especially in conditions where signaling pathways are disrupted. The recombinant production of YPR-10 allows for a controlled study of its properties, offering insights into its biological activities and interactions with other cellular components. Recently, advancements in molecular cloning, expression systems, and purification techniques have facilitated more efficient production of YPR-10, paving the way for in-depth research. Investigating YPR-10 can potentially lead to novel therapeutic strategies, particularly in the context of diseases where traditional treatments have proven inadequate. Overall, the study of YPR-10 as a recombinant protein holds promise for enhancing our understanding of complex biological systems and developing innovative solutions in medical science.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US