Analytical Data
-
Gene name
RABL4
- Application
-
Alternative Names
Intraflagellar transport protein 27 homolog. Putative GTP-binding protein RAY-like. Rab-like protein 4
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BW83
-
Expression Region
1-186 aa
-
AA Sequence
MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
-
Molecular Weight
46.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
RABL4, a member of the Ras-related protein family, plays a crucial role in various cellular processes, including cell proliferation, migration, and differentiation. Its involvement in the regulation of the cytoskeleton and vesicle trafficking highlights its significance in maintaining cellular homeostasis. Recent studies have indicated that RABL4 is highly expressed in several cancer types, suggesting its potential as a biomarker for tumor progression and a target for therapeutic intervention. Researchers have focused on the structural and functional characterization of RABL4 to understand its mechanism of action and contribution to oncogenic pathways. The development of RABL4 recombinant proteins has been pivotal in these studies, allowing for the exploration of its interactions with other cellular molecules, such as GTPases and downstream signaling partners. By utilizing advanced techniques like X-ray crystallography and cryo-electron microscopy, scientists aim to elucidate the three-dimensional structure of RABL4 and its binding affinities, offering insights into drug design. Additionally, understanding the regulatory networks involving RABL4 could reveal novel therapeutic strategies for cancer treatment and other diseases linked to cellular dysfunctions. Through these efforts, RABL4 may emerge as a promising candidate for targeted therapies, contributing to advancements in personalized medicine and improved treatment outcomes. As research progresses, the implications of RABL4 in both basic and translational science continue to expand, emphasizing the importance of this protein in the broader context of cell biology and cancer research.
