Analytical Data
-
Gene name
C1orf38
- Application
-
Alternative Names
Protein THEMIS2. Induced by contact to basement membrane 1 Protein. Protein ICB-1. Thymocyte-expressed molecule involved in selection Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5TEJ8
-
Expression Region
1-111aa
-
AA Sequence
MEGQQVILHLPLSQKGPFWTWEPSAPRTLLQVLQDPALKDLVLTCPTLPWHSLILRPQYEIQAIMHIFSSLRIAATRSAAQTQGEDLARVHQGWLQYVQQDSCPQEGPQAR
-
Molecular Weight
37.95 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf38, also known as Chromosome 1 Open Reading Frame 38, is a gene located on chromosome 1 that encodes a protein with unknown function, making it a subject of considerable interest in the field of molecular biology and genetics. Recent studies have indicated that C1orf38 may play a role in various cellular processes, including cell proliferation and differentiation, which could have implications in cancer research and developmental biology. The protein's potential involvement in regulatory pathways has prompted researchers to explore its expression patterns in different tissues and under various physiological and pathological conditions. Recombinant protein studies of C1orf38 are crucial to elucidate its functional properties, allowing scientists to investigate its interactions with other proteins and its influence on cellular mechanisms. Using techniques such as gene cloning and expression in suitable host systems, researchers aim to produce large quantities of C1orf38 for functional assays and structural analysis. Insights gained from such studies may contribute to a better understanding of its biological role and its potential as a therapeutic target in diseases where its function is altered. Overall, the recombinant protein research of C1orf38 holds promise in uncovering new aspects of cellular regulation and may lead to innovative approaches in treating diseases linked to its dysregulation.
