Analytical Data
-
Gene name
C1orf189
- Application
-
Alternative Names
C1orf189; Uncharacterized Protein C1orf189
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q5VU69
-
Expression Region
1-101aa
-
AA Sequence
MSVEKMTKVEESFQKAMGLKKTVDRWRNSHTHCLWQMALGQRRNPYATLRMQDTMVQELALAKKQLLMVRQAALHQLFEKEHQQYQQELNQMGKAFYVERF
-
Molecular Weight
11.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1orf189, also known as Chromosome 1 open reading frame 189, is a gene located on chromosome 1 that has gained attention in recent years due to its potential role in various biological processes. Initial studies have suggested that C1orf189 may be involved in cellular proliferation and differentiation, positioning it as a candidate gene for investigations in cancer biology and other diseases. The protein encoded by C1orf189 exhibits characteristics indicative of involvement in cellular signaling pathways, though its precise functions remain poorly understood. Additionally, polymorphisms in the C1orf189 gene have been associated with susceptibility to certain autoimmune diseases, further emphasizing the need for comprehensive studies on its role in immune regulation. Researchers aim to develop recombinant C1orf189 protein to elucidate its structural properties and functional mechanisms. By producing this protein in a controlled laboratory environment, scientists can investigate its interactions with other biomolecules and identify potential therapeutic targets. Understanding the role of C1orf189 in disease mechanisms could pave the way for novel diagnostic and therapeutic strategies, making it a significant focus in molecular biology and translational medicine. Through advanced techniques in protein expression and purification, the study of recombinant C1orf189 not only holds promise for illuminating its biological significance but also for contributing to a broader understanding of the molecular basis of diseases linked to this gene.
