Cat: PA2000-2261

Recombinant Human TPD52 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    TPD52

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    TPD52;Tumor Protein D52

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55327

  • Expression Region

    1-184aa

  • AA Sequence

    MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL

  • Molecular Weight

    35.9 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

TPD52 (Tumor Protein D52) is a member of the tumor protein family, which is implicated in various cellular processes, including cell growth, differentiation, and apoptosis. Initial studies have suggested that TPD52 may play a significant role in oncogenesis and tumor progression, particularly in breast, prostate, and other types of cancers. The protein is believed to be involved in the regulation of cellular signaling pathways that affect cell proliferation and survival. As a result, TPD52 has garnered attention as a potential biomarker for cancer diagnosis and prognosis, as well as a target for therapeutic interventions. Research into the recombinant expression of TPD52 has been accelerated in recent years, enabling investigations into its structure and function. By producing TPD52 in a recombinant system, researchers can obtain large quantities of the protein for biochemical assays, structural studies, and functional analyses, crucial for elucidating its role in cancer biology. Furthermore, understanding the mechanisms by which TPD52 influences tumorigenesis could pave the way for the development of novel cancer treatments that specifically target this protein. Overall, TPD52 represents a promising area of research in cancer biology, with implications for diagnostic, prognostic, and therapeutic strategies in oncology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US