Analytical Data
-
Gene name
TPD52
- Application
-
Alternative Names
TPD52；Tumor Protein D52
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55327
-
Expression Region
1-184aa
-
AA Sequence
MDRGEQGLLRTDPVPEEGEDVAATISATETLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQDVTATSAYKKTSETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
-
Molecular Weight
35.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TPD52 (Tumor Protein D52) is a member of the tumor protein family, which is implicated in various cellular processes, including cell growth, differentiation, and apoptosis. Initial studies have suggested that TPD52 may play a significant role in oncogenesis and tumor progression, particularly in breast, prostate, and other types of cancers. The protein is believed to be involved in the regulation of cellular signaling pathways that affect cell proliferation and survival. As a result, TPD52 has garnered attention as a potential biomarker for cancer diagnosis and prognosis, as well as a target for therapeutic interventions. Research into the recombinant expression of TPD52 has been accelerated in recent years, enabling investigations into its structure and function. By producing TPD52 in a recombinant system, researchers can obtain large quantities of the protein for biochemical assays, structural studies, and functional analyses, crucial for elucidating its role in cancer biology. Furthermore, understanding the mechanisms by which TPD52 influences tumorigenesis could pave the way for the development of novel cancer treatments that specifically target this protein. Overall, TPD52 represents a promising area of research in cancer biology, with implications for diagnostic, prognostic, and therapeutic strategies in oncology.
