Analytical Data
-
Gene name
TMLHE
- Application
-
Alternative Names
TMLHE；TMLH；Trimethyllysine dioxygenase. mitochondrial
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NVH6
-
Expression Region
16-376aa
-
AA Sequence
LLKGGVIYPALPQPNFKSLLPLAVHWHHTASKSLTCAWQQHEDHFELKYANTVMRFDYVWLRDHCRSASCYNSKTHQRSLDTASVDLCIKPKTIRLDETTLFFTWPDGHVTKYDLNWLVKNSYEGQKQKVIQPRILWNAEIYQQAQVPSVDCQSFLETNEGLKKFLQNFLLYGIAFVENVPPTQEHTEKLAERISLIRETIYGRMWYFTSDFSRGDTAYTKLALDRHTDTTYFQEPCGIQVFHCLKHEGTGGRTLLVDGFYAAEQVLQKAPEEFELLSKVPLKHEYIEDVGECHNHMIGIGPVLNIYPWNKELYLIRLFKEKQNTVNRQWNSSLQCDIPERILTYRHFVSGTSIEHRGSLI
-
Molecular Weight
46.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMLHE (Trimethyllysine Hydroxylase) is an enzyme involved in the metabolic pathways of trimethyllysine, an amino acid derivative, which plays a key role in the biosynthesis of carnitine—a molecule essential for fatty acid metabolism in cells. The study of TMLHE and its recombinant forms has gained significant attention due to its implications in metabolic disorders, energy homeostasis, and potential therapeutic applications. Mutations or deficiencies in TMLHE can lead to a reduction in carnitine levels, resulting in various health issues, including muscle weakness, cardiomyopathy, and impaired fatty acid metabolism. By producing recombinant TMLHE, researchers aim to elucidate the enzyme's structure-function relationship, understand its catalytic mechanisms, and explore its role in metabolic diseases. Additionally, recombinant TMLHE can be utilized in the development of diagnostic tools and possible treatments for conditions associated with altered carnitine metabolism. The characterization of this enzyme is critical not only for understanding fundamental biochemical processes but also for advancing potential therapeutic strategies that could address related health complications. Overall, the research surrounding TMLHE and its recombinant protein forms offers promising avenues for improving our comprehension of metabolic pathways and their relevance to human health.
