Cat: PA1000-5407

Recombinant Human MAP2K4 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MAP2K4

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MAP2K4;JNKK1;MEK4;MKK4;Dual specificity mitogen-activated Protein kinase kinase 4

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P45985

  • Expression Region

    33-399aa

  • AA Sequence

    AVSSMQGKRKALKLNFANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIE SSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKMVHKPSGQIMAVKR IRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICMELMS TSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKP SNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQ GYDVRSDVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSE EREFSPSFINFVNLCLTKDESKRPKYKELLKHPFILMYEERAVEVACYVC KILDQMPATPSSPMYVD

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MAP2K4, also known as MKK4, is a crucial kinase in the mitogen-activated protein kinase (MAPK) signaling pathway, playing a vital role in cellular processes such as proliferation, differentiation, and stress response. As a dual-specificity kinase, MAP2K4 facilitates the activation of downstream MAPK proteins, including JUN N-terminal kinase (JNK) and p38 MAP kinase, which are involved in important physiological and pathological processes, including inflammation, apoptosis, and oncogenesis. Aberrant expression or mutation of MAP2K4 has been implicated in various cancers and inflammatory diseases, making it a potential therapeutic target. Researchers have focused on the recombinant expression of MAP2K4 to better understand its functional mechanisms and interactions within signaling networks. The production of recombinant MAP2K4 enables detailed structural and functional studies, allowing for the identification of specific substrates and the elucidation of its regulatory role in cancer progression and response to therapy. Understanding MAP2K4's mechanistic pathways is essential for developing targeted therapies that exploit its role in disease, thereby offering potential for novel intervention strategies in cancer and other related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US