Analytical Data
-
Gene name
TMEM2
- Application
-
Alternative Names
TMEM2；KIAA1412；TMEM2；Inactive cell surface hyaluronidase CEMIP2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9UHN6
-
Expression Region
104-250aa
-
AA Sequence
SSKYAPDENCPDQNPRLRNWDPGQDSAKQVVIKEGDMLRLTSDATVHSIVIQDGGLLVFGDNKDGSRNITLRTHYILIQDGGALHIGAEKCRYKSKATITLYGKSDEGESMPTFGKKFIGVEAGGTLELHGARKASWTLLARTLNSS
-
Molecular Weight
21.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM2, or Transmembrane Protein 2, has garnered significant attention in recent years within the fields of cellular biology and biochemistry due to its potential roles in various physiological and pathological processes. Emerging evidence suggests that TMEM2 is involved in critical cellular functions, including membrane trafficking and cell signaling, which may have implications in cancer progression and neurodegenerative diseases. As a member of the transmembrane protein family, TMEM2's structure suggests a complex interaction with the cellular membrane, making it an intriguing candidate for studying membrane dynamics. Moreover, the recombinant expression of TMEM2 in various model systems allows researchers to investigate its functional characteristics and interactions in a controlled environment. This not only aids in elucidating its biological role but also contributes to understanding its potential as a therapeutic target. Given that many transmembrane proteins are implicated in disease mechanisms, the study of TMEM2 is paving the way for innovative approaches in drug development and treatment strategies, highlighting the importance of continuing research in this area.
