Analytical Data
-
Gene name
TMEM14B
- Application
-
Alternative Names
TMEM14B；Transmembrane Protein 14B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUH8
-
Expression Region
1-114aa
-
AA Sequence
MEKPLFPLVPLHWFGFGYTALVVSGGIVGYVKTGSVPSLAAGLLFGSLAGLGAYQLYQDPRNVWGFLAATSVTFVGVMGMRSYYYGKFMPVGLIAGASLLMAAKVGVRMLMTSD
-
Molecular Weight
39.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM14B (Transmembrane protein 14B) is a protein that has garnered attention in recent years due to its potential roles in cellular processes and its implications in various diseases. It is classified as a transmembrane protein, indicating its localization in cellular membranes, where it may participate in transport and signaling pathways. Research has suggested that TMEM14B is involved in mitochondrial function and plays a crucial role in cellular metabolism, particularly in different types of cancer and neurodegenerative disorders. The study of recombinant TMEM14B proteins is essential for understanding their structure-function relationships, which can provide insights into their biological roles and mechanisms of action. By producing and analyzing recombinant TMEM14B, researchers can explore its interactions with other biomolecules and its potential involvement in pathophysiological processes. Furthermore, recombinant TMEM14B can be a valuable tool for developing therapeutic strategies, including targeted treatments for diseases linked to its dysfunction. Overall, the investigation of TMEM14B and its recombinant variants is a promising area of study that may lead to significant advancements in our understanding of cell biology and disease mechanisms, potentially paving the way for novel therapeutic interventions.
