Analytical Data
-
Gene name
C1GALT1C1
- Application
-
Alternative Names
HSPC067; 3-galactosyltransferase 2; Beta 1.3 galactosyltransferase 2 ; Beta1.3 galactosyltransferase 2 ; C1Gal T2 ; C1Gal-T2; C1GALT1 specific chaperone 1 ; C1GALT1-specific chaperone 1; C1galt1c1; C1GalT2; C1GLC_HUMAN; C38H2 L1; C38H2 like Protein 1; C38H2-L1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q96EU7
-
Expression Region
1-318aa
-
AA Sequence
MLSESSSFLKGVMLGSIFCALITMLGHIRIGHGNRMHHHEHHHLQAPNKEDILKISEDERMELSKSFRVYCIILVKPKDVSLWAAVKETWTKHCDKAEFFSSENVKVFESINMDTNDMWLMMRKAYKYAFDKYRDQYNWFFLARPTTFAIIENLKYFLLKKDPSQPFYLGHTIKSGDLEYVGMEGGIVLSVESMKRLNSLLNIPEKCPEQGGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVFNTKSVGLSIKEAMTYHPNQVVEGCCSDMAVTFNGLTPNQMHVMMYGVYRLRAFGHIFNDALVFLPPNGSDND
-
Molecular Weight
60.72 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C1GALT1C1, also known as Galactosyltransferase 1, is a key enzyme involved in the biosynthesis of the Tn antigen, a carbohydrate structure associated with various cancers. The study of C1GALT1C1 has gained significant attention due to its role in the aberrant glycosylation of proteins and lipids in tumor cells, which can influence tumor progression, immune evasion, and metastasis. Dysregulated expression of C1GALT1C1 has been implicated in several malignancies, making it a potential biomarker for cancer diagnosis and prognosis. Furthermore, understanding the molecular mechanisms regulating C1GALT1C1 activity could lead to innovative therapeutic strategies that target glycosylation pathways in cancer treatment. Research on recombinant C1GALT1C1 proteins aims to elucidate its structure-function relationships and catalytic mechanisms, providing insights into its biological significance and potential as a target for drug development. By generating and characterizing these recombinant proteins, scientists hope to better understand the enzyme's role in glycan biosynthesis and its implications in tumor biology, ultimately contributing to more effective cancer therapies.
