Analytical Data
-
Gene name
C19orf80
- Application
-
Alternative Names
ANGPTL8; C19orf80; RIFL; UNQ599/PRO1185Angiopoietin-like Protein 8; Betatrophin; Lipasin; Refeeding-induced fat and liver Protein
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6UXH0
-
Expression Region
1-251aa
-
AA Sequence
MGDALPPFPGAQPLTGRAWLGSSPVMYCTRTARLRTEPWRLLKLRLLYLRPSVMPVPALCLLWALAMVTRPASAAPMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA
-
Molecular Weight
54.56 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C19orf80, also known as Chromosome 19 Open Reading Frame 80, is a gene located on chromosome 19 and has garnered interest due to its potential roles in various biological processes, including cell cycle regulation and the immune response. Initial studies indicated that C19orf80 might play a significant role in tumorigenesis and cellular differentiation, highlighting the need for a deeper understanding of its functional properties. Researchers have been particularly focused on the production and characterization of recombinant C19orf80 protein to clarify its biological functions and mechanisms of action. This involves using various expression systems, such as bacterial or eukaryotic cells, to produce the protein in sufficient quantities for detailed analysis. Through techniques like structural biology, proteomics, and cellular assays, scientists aim to elucidate how C19orf80 interacts with other cellular components and regulates critical pathways. Understanding the functional attributes of C19orf80 could provide valuable insights into its role in health and disease, especially in cancer biology, where aberrations in its expression or function might contribute to oncogenesis. As research progresses, the recombinant protein serves as a pivotal tool for developing potential therapeutic strategies and diagnostic markers related to conditions influenced by C19orf80 dysregulation. Overall, the study of C19orf80 and its recombinant protein is crucial for advancing our knowledge in molecular biology and could lead to significant breakthroughs in targeted treatments for various diseases.











