Analytical Data
-
Gene name
TMEM132A
- Application
-
Alternative Names
TMEM132A;HSPA5BP1;KIAA1583;Transmembrane Protein 132A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q24JP5
-
Expression Region
642-742aa
-
AA Sequence
QPVMGISLTLSRGTAHPGEVTATCWAQSALPAPKQEVALSLWLSFSDHTVAPAELYDRRDLGLSVSAEEPGAILPAEEQGAQLGVVVSGAGAEGLPLHVAL
-
Molecular Weight
17.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TMEM132A, a member of the transmembrane protein family, has garnered significant interest in recent years due to its potential role in various physiological and pathological processes. Located on chromosome 1q21, TMEM132A is believed to be involved in immune responses and cell adhesion, making it a candidate for studies related to autoimmune diseases, cancer, and neural disorders. Research has shown that alterations in TMEM132A expression levels may be linked to conditions such as schizophrenia and anxiety disorders, highlighting its relevance in neuropsychiatric research. The production of recombinant TMEM132A protein has become a focal point for investigating its biological functions, structure, and interactions with other cellular components. Utilizing techniques like recombinant DNA technology and mammalian expression systems, researchers aim to generate sufficient quantities of functional TMEM132A for in vitro and in vivo studies. Understanding the mechanisms by which TMEM132A operates may open new avenues for therapeutic interventions and biomarker development. Thus, the investigation of recombinant TMEM132A protein not only contributes to the fundamental understanding of transmembrane proteins but also holds promise for translational applications in medicine.











