Cat: PA2000-6080

Recombinant Human C19orf66 Protein,GST

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    C19orf66

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    SHFL; C19orf66; FLJ11286; IRAV; RYDEN; SFL; Shiftless antiviral inhibitor of ribosomal frameshifting Protein; SFL; SHFL; Interferon-regulated antiviral Protein; IRAV; Repressor of yield of DENV Protein; RyDEN

  • Species

    Human

  • Source

    E. coli

  • Tag

    GST-tag at N-terminal

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9NUL5

  • Expression Region

    1-163aa

  • AA Sequence

    MSQEGVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKCRKRYEPVPADKMWGLAEFHCPKCRHNFR

  • Molecular Weight

    45.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

C19orf66, also known as "Chromosome 19 Open Reading Frame 66," has garnered attention in recent years due to its potential role in various biological processes and diseases. Research indicates that this protein may be involved in cellular functions such as signal transduction, cell growth, and apoptosis. Additionally, alterations in C19orf66 expression have been linked to neurodevelopmental disorders, emphasizing its significance in neurological research. The interest in C19orf66 also stems from its possible involvement in cancer biology, where aberrations in its expression may contribute to tumorigenesis. Given these implications, the recombinant expression of C19orf66 protein is essential for elucidating its function and mechanism of action. Developing and characterizing recombinant C19orf66 can provide insights into its structure-function relationships, as well as its interactions with other cellular components. Furthermore, understanding the role of C19orf66 in pathophysiological conditions may open new avenues for therapeutic interventions. Overall, the study of C19orf66 serves as a key element in the broader context of molecular biology and medicine, highlighting the need for continued research into its biological significance and potential clinical applications.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US