Analytical Data
-
Gene name
C19orf66
- Application
-
Alternative Names
SHFL; C19orf66; FLJ11286; IRAV; RYDEN; SFL; Shiftless antiviral inhibitor of ribosomal frameshifting Protein; SFL; SHFL; Interferon-regulated antiviral Protein; IRAV; Repressor of yield of DENV Protein; RyDEN
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NUL5
-
Expression Region
1-163aa
-
AA Sequence
MSQEGVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSNDLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDDLIPAVDRQFACSSCDHVWWRRVPQRKEVSRCRKCRKRYEPVPADKMWGLAEFHCPKCRHNFR
-
Molecular Weight
45.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C19orf66, also known as "Chromosome 19 Open Reading Frame 66," has garnered attention in recent years due to its potential role in various biological processes and diseases. Research indicates that this protein may be involved in cellular functions such as signal transduction, cell growth, and apoptosis. Additionally, alterations in C19orf66 expression have been linked to neurodevelopmental disorders, emphasizing its significance in neurological research. The interest in C19orf66 also stems from its possible involvement in cancer biology, where aberrations in its expression may contribute to tumorigenesis. Given these implications, the recombinant expression of C19orf66 protein is essential for elucidating its function and mechanism of action. Developing and characterizing recombinant C19orf66 can provide insights into its structure-function relationships, as well as its interactions with other cellular components. Furthermore, understanding the role of C19orf66 in pathophysiological conditions may open new avenues for therapeutic interventions. Overall, the study of C19orf66 serves as a key element in the broader context of molecular biology and medicine, highlighting the need for continued research into its biological significance and potential clinical applications.
