Analytical Data
-
Gene name
TIMM17A
- Application
-
Alternative Names
TIMM17A；MIMT17；TIM17；TIM17A；Mitochondrial import inner membrane translocase subunit Tim17-A
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q99595
-
Expression Region
1-171aa
-
AA Sequence
MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAIKGFRNSPVGVNHRLRGSLTAIKTRAPQLGGSFAVWGGLFSMIDCSMVQVRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEGAGILLTRFASAQFPNGPQFAEDPSQLPSTQLPSSPFGDYRQYQ
-
Molecular Weight
45.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
TIMM17A (Translocase of Inner Mitochondrial Membrane 17 A) is a crucial protein involved in the import of mitochondrial proteins, playing a key role in mitochondrial biogenesis and function. Understanding TIMM17A is vital, as it has implications for various mitochondrial-related disorders, which are often linked to energy metabolism failures and neurodegenerative diseases. Recent research has focused on the structural and functional characterization of TIMM17A to elucidate its mechanisms in protein translocation across the mitochondrial membrane. Studies have demonstrated that TIMM17A forms a complex with other translocase components, facilitating the passage of precursor proteins into mitochondria. Additionally, alterations in TIMM17A expression levels have been associated with specific pathologies, indicating its potential as a biomarker or therapeutic target. By producing and studying recombinant TIMM17A, researchers aim to investigate its interaction with other mitochondrial proteins and to explore its functional significance in mitochondrial uptake mechanisms. This research could pave the way for novel strategies in treating mitochondrial disorders by enhancing our understanding of mitochondrial dynamics and identification of therapeutic interventions targeting the TIMM17A pathway.
