Cat: PA1000-5387

Recombinant Human CA9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    CA9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    CA9;Collagen alpha-1(IX) chain

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q16790

  • Expression Region

    59-414aa

  • AA Sequence

    PLGEEDLPSEEDSPREEDPPGEEDLPGEEDLPGEEDLPEVKPKSEEEGSL KLEDLPTVEAPGDPQEPQNNAHRDKEGDDQSHWRYGGDPPWPRVSPACAG RFQSPVDIRPQLAAFCPALRPLELLGFQLPPLPELRLRNNGHSVQLTLPP GLEMALGPGREYRALQLHLHWGAAGRPGSEHTVEGHRFPAEIHVVHLSTA FARVDEALGRPGGLAVLAAFLEEGPEENSAYEQLLSRLEEIAEEGSETQV PGLDISALLPSDFSRYFQYEGSLTTPPCAQGVIWTVFNQTVMLSAKQLHT LSDTLWGPGDSRLQLNFRATQPLNGRVIEASFPAGVDSSPRAAEPVQLNS CLAAGD

  • Molecular Weight

    39 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Research on CA9 (Carbonic Anhydrase IX) recombinant proteins has gained significant attention due to the enzyme's critical role in cancer biology and its potential as a therapeutic target. CA9 is a membrane-bound protein that is frequently overexpressed in various tumors, particularly in renal cell carcinoma, making it a promising biomarker for cancer diagnosis and prognosis. The enzyme facilitates the conversion of carbon dioxide to bicarbonate and protons, playing a vital role in maintaining acid-base balance and promoting tumor growth in hypoxic conditions. Researchers have been focusing on the recombinant expression of CA9 to better understand its structure-function relationships, validate its role in tumor microenvironments, and explore its interactions with signaling pathways that contribute to cancer progression. Utilizing recombinant CA9 proteins allows for detailed studies of enzymatic activity, inhibitor screening, and the development of targeted therapies, including immunotherapies and small molecule inhibitors. Furthermore, the production of CA9 in a recombinant system enables high yield and purity, facilitating the study of its physiological and pathological roles. The ongoing exploration of CA9 not only enhances our understanding of cancer metabolism but also holds promise for innovative therapeutic strategies aimed at exploiting the vulnerabilities associated with CA9 overexpression in various malignancies.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US