Analytical Data
-
Gene name
C19orf40
- Application
-
Alternative Names
Fanconi anemia core complex-associated Protein 24. Fanconi anemia-associated Protein of 24 kDa
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BTP7
-
Expression Region
1-215aa
-
AA Sequence
MEKNPPDDTGPVHVPLGHIVANEKWRGSQLAQEMQGKIKLIFEDGLTPDFYLSNRCCILYVTEADLVAGNGYRKRLVRVRNSNNLKGIVVVEKTRMSEQYFPALQKFTVLDLGMVLLPVASQMEASCLVIQLVQEQTKEPSKNPLLGKKRALLLSEPSLLRTVQQIPGVGKVKAPLLLQKFPSIQQLSNASIGELEQVVGQAVAQQIHAFFTQPR
-
Molecular Weight
50.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C19orf40, also known as Caspase-activated Protein 1 (CAP1), is a protein that has garnered significant interest in recent years due to its potential roles in cellular processes such as apoptosis and cell proliferation. Research indicates that C19orf40 may be involved in various physiological and pathological conditions, including cancer and neurodegenerative diseases. The gene encoding this protein is located on chromosome 19, and its expression has been associated with the regulation of caspase activity, playing a crucial role in programmed cell death. Given the importance of apoptosis in maintaining cellular homeostasis and its implications in disease, the study of C19orf40 as a recombinant protein has become a focal point of investigation. Scientists aim to elucidate its structure, functional mechanisms, and interactions with other cellular components, which are essential for several biological pathways. Furthermore, the development of recombinant C19orf40 allows for the exploration of its potential as a biomarker and therapeutic target, particularly in cancer research, where dysregulation of apoptotic pathways is prevalent. By generating recombinant forms of this protein, researchers can conduct functional assays, high-throughput screening, and structural studies to better understand its biological significance and therapeutic potential. Overall, the exploration of C19orf40 as a recombinant protein embodies a promising avenue for advancing our understanding of cell death mechanisms and their relevance to human health and disease.
