Analytical Data
-
Gene name
C19orf39
- Application
-
Alternative Names
ATPase SWSAP1; C19orf39; SWAP1_HUMAN; SWIM-type zinc finger 7-associated Protein 1; SWS1-associated Protein 1; SWS1AP1; SWSAP1; Zinc finger SWIM type containing 7 associated Protein 1; ZSWIM7-associated Protein 1; ZSWIM7AP1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6NVH7
-
Expression Region
1-229aa
-
AA Sequence
MNHKVHHHHHHMPAAGPPLLLLGTPGSGKTALLFAAALEAAGEGQGPVLF LTRRPLQSMPRGTGTTLDPMRLQKIRFQYPPSTRELFRLLCSAHEAPGPA PSLLLLDGLEEYLAEDPEPQEAAYLIALLLDTAAHFSHRLGPGRDCGLMV ALQTQEEAGSGDVLHLALLQRYFPAQCWLQPDAPGPGEHGLRACLEPGGL GPRTEWWVTFRSDGEMMIAPWPTQAGDPSSGKGSSSGGQP
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C19orf39, also known as the "Chromosome 19 Open Reading Frame 39," is a gene located on chromosome 19 that has garnered attention in recent years due to its potential implications in various biological processes, including cell proliferation, differentiation, and immune response. Research suggests that C19orf39 may play a crucial role in the regulation of key pathways associated with certain diseases, including cancer. Its molecular functions are still being elucidated, prompting scientists to investigate the properties and applications of recombinant C19orf39 proteins. Producing these proteins in recombinant systems allows for in-depth studies of their structure, function, and potential interactions with other cellular components. Additionally, understanding the role of C19orf39 in different cellular contexts may uncover its significance as a biomarker for disease or a target for therapeutic intervention. As the exploration of C19orf39 continues, it holds promise for advancing our knowledge of cellular mechanisms and developing new strategies for disease management.
