Cat: PA1000-5339

Recombinant Human FGF8a Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    FGF8a

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    FGF8a;FGF19;Fibroblast growth factor

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P55075-2

  • Expression Region

    23-204aa

  • AA Sequence

    QHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPF AKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIV LENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHH TTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR

  • Molecular Weight

    21 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Fibroblast growth factor 8 (FGF8) is a member of the fibroblast growth factor family, which plays a critical role in embryonic development, cell differentiation, and tissue repair. FGF8 exists in multiple isoforms, with FGF8a being one of the most studied. This protein is known to participate in various biological processes, including limb and brain development, through its ability to interact with specific receptors and activate intracellular signaling pathways. Research into FGF8a has gained traction due to its implications in several pathological conditions, including cancer, where aberrant FGF signaling may promote tumor growth and metastasis. Additionally, FGF8a's role in neurogenesis and potential therapeutic applications in regenerative medicine have made it a focal point of scientific inquiry. The production of recombinant FGF8a has become essential for in vitro studies, enabling researchers to investigate its functional properties and therapeutic potential. These studies aim to elucidate the mechanisms by which FGF8a influences cellular behavior, thus providing insights that could lead to innovative treatments for diseases linked to dysregulated FGF signaling. Overall, the study of recombinant FGF8a not only enhances our understanding of developmental biology but also opens new avenues for targeted therapies in oncology and regenerative medicine.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US