Analytical Data
-
Gene name
FGF8a
- Application
-
Alternative Names
FGF8a；FGF19；Fibroblast growth factor
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P55075-2
-
Expression Region
23-204aa
-
AA Sequence
QHVREQSLVTDQLSRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPF AKLIVETDTFGSRVRVRGAETGLYICMNKKGKLIAKSNGKGKDCVFTEIV LENNYTALQNAKYEGWYMAFTRKGRPRKGSKTRQHQREVHFMKRLPRGHH TTEQSLRFEFLNYPPFTRSLRGSQRTWAPEPR
-
Molecular Weight
21 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Fibroblast growth factor 8 (FGF8) is a member of the fibroblast growth factor family, which plays a critical role in embryonic development, cell differentiation, and tissue repair. FGF8 exists in multiple isoforms, with FGF8a being one of the most studied. This protein is known to participate in various biological processes, including limb and brain development, through its ability to interact with specific receptors and activate intracellular signaling pathways. Research into FGF8a has gained traction due to its implications in several pathological conditions, including cancer, where aberrant FGF signaling may promote tumor growth and metastasis. Additionally, FGF8a's role in neurogenesis and potential therapeutic applications in regenerative medicine have made it a focal point of scientific inquiry. The production of recombinant FGF8a has become essential for in vitro studies, enabling researchers to investigate its functional properties and therapeutic potential. These studies aim to elucidate the mechanisms by which FGF8a influences cellular behavior, thus providing insights that could lead to innovative treatments for diseases linked to dysregulated FGF signaling. Overall, the study of recombinant FGF8a not only enhances our understanding of developmental biology but also opens new avenues for targeted therapies in oncology and regenerative medicine.
