Analytical Data
-
Gene name
SSX4
- Application
-
Alternative Names
SSX4;SSX4A;SSX4B;Protein SSX4
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O60224
-
Expression Region
1-188aa
-
AA Sequence
MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE
-
Molecular Weight
25.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SSX4, a member of the cancer/testis (CT) antigen family, is predominantly expressed in human germ cells and various tumors, making it a valuable target for cancer immunotherapy. The research surrounding SSX4 has gained traction due to its immunogenic properties, which allow for the development of therapeutic vaccines and cellular therapies aimed at eliciting an immune response against malignancies. Initially identified within the context of melanoma and other solid tumors, SSX4 has been linked to various cancers, raising interest in its mechanistic role in tumorigenesis and potential as a biomarker for early detection and prognosis. Moreover, the expression of SSX4 in normal tissues, combined with its restricted expression in tumor cells, makes it an ideal candidate for targeted therapeutic interventions with minimal off-target effects. Recent studies have focused on elucidating the structure-function relationship of the SSX4 protein, its interactions with immune cells, and the pathways influencing its expression. Progress has also been made in understanding its post-translational modifications and their impact on immunogenicity. As cancer therapy continues to evolve towards personalized medicine, the exploration of SSX4 as a target for immunotherapy and its integration into combination treatment strategies presents promising avenues for enhancing patient outcomes in cancer care. Thus, ongoing research into SSX4 and its associated molecular mechanisms is critical for developing innovative approaches to cancer treatment leveraging the body's innate immune response.











