Analytical Data
-
Gene name
PTGS1
- Application
-
Alternative Names
Cyclooxygenase-1;COX-1;Prostaglandin H2 synthase 1;PGH synthase 1;PGHS-1;PHS 1;Prostaglandin-endoperoxide synthase 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P23219
-
Expression Region
24-599 aa
-
AA Sequence
ADPGAPTPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPGLWTWLRNSLRPSPSFTHFLLTHGRWFWEFVNATFIREMLMRLVLTVRSNLIPSPPTYNSAHDYISWESFSNVSYYTRILPSVPKDCPTPMGTKGKKQLPDAQLLARRFLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQVLDGEMYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATLWLREHNRVCDLLKAEHPTWGDEQLFQTTRLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGVQFQYRNRIAMEFNHLYHWHPLMPDSFKVGSQEYSYEQFLFNTSMLVDYGVEALVDAFSRQIAGRIGGGRNMDHHILHVAVDVIRESREMRLQPFNEYRKRFGMKPYTSFQELVGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEIGAPFSLKGLLGNPICSPEYWKPSTFGGEVGFNIVKTATLKKLVCLNTKTCPYVSFRVPDASQDDGPAVERPSTEL
-
Molecular Weight
71 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTGS1, also known as Cyclooxygenase-1 (COX-1), is a key enzyme involved in the conversion of arachidonic acid to prostaglandins, which play critical roles in various physiological processes, including inflammation, gastric protection, and renal function. Research on PTGS1 has gained prominence due to its implications in various diseases, particularly in the context of pain, inflammation, and cardiovascular disorders. Nonsteroidal anti-inflammatory drugs (NSAIDs), which inhibit COX-1 activity, have been widely used for pain management but are associated with gastrointestinal side effects due to decreased protective prostaglandin levels. This has led to increased interest in developing selective inhibitors that target COX-2, an isoform associated with inflammation, while sparing COX-1 to mitigate adverse effects. The recombinant production of PTGS1 allows for in-depth studies of its structure, function, and regulation, facilitating the discovery of new therapeutics aimed at selectively modulating its activity. Additionally, understanding the molecular mechanisms governing PTGS1's role in disease pathology could provide valuable insights for drug development, highlighting the importance of recombinant PTGS1 in pharmacological and biotechnological research.
