Analytical Data
-
Gene name
C18orf21
- Application
-
Alternative Names
C18orf21; XTP13; PNAS-124; PNAS-131UPF0711 Protein C18orf21; HBV X-transactivated gene 13 Protein; HBV XAg-transactivated Protein 13
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q32NC0
-
Expression Region
1-132aa
-
AA Sequence
MVKKFKDSKSVLLITCKTCNRTVKHHGKSRSFVSTLKSNPATPASKLSLKTPERRTANPNHDMSGSKGKSPASVFRTPTSGQSVSTCSSKNTSKTKKHFSQLKMLLSQNESQKIPKVDFRNFLSSLKGGLLK
-
Molecular Weight
40.92 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C18orf21, also known as chromosome 18 open reading frame 21, is a gene located on chromosome 18 that encodes a protein of interest in various research contexts, primarily due to its potential involvement in several cellular processes. Studies have suggested that C18orf21 may play a role in cellular functions such as proliferation, apoptosis, and response to stresses, making it a candidate for investigating its implications in diseases, including cancer and genetic disorders. Due to its uncertain biological function, researchers have expressed interest in generating recombinant C18orf21 protein to characterize its properties and elucidate its role within the cell. The recombinant protein serves as a valuable tool for developing assays that can provide insights into its interactions with other biomolecules and its regulation within cellular pathways. Additionally, understanding C18orf21's structure and function could pave the way for exploring its potential as a therapeutic target in diseases where its dysregulation is implicated. The investigation of C18orf21 and its recombinant protein thus represents a promising area of research that could contribute to broader knowledge in molecular biology and translational medicine.
