Analytical Data
-
Gene name
PTGER3
- Application
-
Alternative Names
(PGE receptor EP3 subtype)(PGE2 receptor EP3 subtype)(PGE2-R)(Prostanoid EP3 receptor)
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P43115
-
Expression Region
1-53 aa
-
AA Sequence
MKETRGYGGDAPFCTRLNHSYTGMWAPERSAEARGNLTRPPGSGEDCGSVSVA
-
Molecular Weight
12.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTGER3, also known as the prostaglandin E receptor 3, is a G-protein coupled receptor that plays a crucial role in mediating the physiological effects of prostaglandin E2 (PGE2). PGE2 is a lipid compound that is involved in a variety of biological processes, including inflammation, immune response, pain sensation, and the regulation of tissue homeostasis. The PTGER3 receptor is particularly notable for its anti-inflammatory properties, making it a significant target for therapeutic interventions in diseases characterized by excessive inflammation, such as autoimmune disorders and chronic inflammatory diseases. The functional characterization of PTGER3, including its signal transduction mechanisms and interaction with various ligands, has been the focus of extensive research. Recombination techniques have enabled the production of PTGER3 recombinant proteins, which are vital for elucidating its structural and functional properties, screening potential drug candidates, and validating its role in various biological pathways. Understanding the receptor's mechanistic pathways opens new avenues for developing novel therapeutics aimed at modulating PGE2 signaling in disease contexts. The ongoing research on PTGER3 also holds promise for advancing our knowledge of receptor biology and its implications in health and disease.
