Analytical Data
-
Gene name
Sprr2a1
- Application
-
Alternative Names
Sprr2a1；Sprr2a；Small proline-rich Protein 2A1
-
Species
Mouse
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9CQK8
-
Expression Region
1-83aa
-
AA Sequence
MSYYQQQCNQPCRPPPVCPPPKCPEPCPPQVWPGPCRPVMCFEPCLPSVWPGPCRPVVCYEQCPPQPWQSTCPPVQFPPCQQK
-
Molecular Weight
13.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Sprr2a1, also known as small proline-rich protein 2A1, is a member of the proline-rich protein family primarily involved in the structural composition of epithelial tissues. This protein plays a crucial role in various cellular processes, including stress response, differentiation, and apoptosis. It is particularly significant in the context of skin, where it contributes to the formation and maintenance of the epidermal barrier. Research into Sprr2a1's functions has gained momentum due to its potential implications in skin diseases such as psoriasis and atopic dermatitis. Recent studies have focused on the expression profiles of Sprr2a1 during pathological conditions, revealing its involvement in inflammatory responses and skin homeostasis. Additionally, the generation of recombinant Sprr2a1 protein provides a valuable tool for investigating its biochemical properties and interactions at the molecular level. Such studies aim to elucidate the underlying mechanisms through which Sprr2a1 influences cellular functions and contribute to the development of therapeutic strategies targeting skin-related disorders. Understanding the role of Sprr2a1 in these contexts could unveil new insights into dermatological health and disease mechanisms, highlighting its importance in both basic and applied research.
