Analytical Data
-
Gene name
SNX24
- Application
-
Alternative Names
SNX24；Sorting nexin-24
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9Y343
-
Expression Region
1-169aa
-
AA Sequence
MEVYIPSFRYEESDLERGYTVFKIEVLMNGRKHFVEKRYSEFHALHKKLKKCIKTPEIPSKHVRNWVPKVLEQRRQGLETYLQAVILENEELPKLFLDFLNVRHLPSLPKAESCGSFDETESEESSKLSHQPVLLFLRDPYVLPAASDFPNVVIEGVLHGIFYPHLQPR
-
Molecular Weight
35.8 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SNX24, a member of the sorting nexin protein family, plays a crucial role in intracellular trafficking and sorting of proteins. This protein is known to be involved in the regulation of endosomal and lysosomal pathways, influencing cellular processes such as receptor recycling and degradation. Recent studies suggest that SNX24 may have significant implications in various diseases, including cancer, where it can affect tumor progression through modulation of signaling pathways. Additionally, there is growing interest in the therapeutic potential of targeting SNX24 in various cellular contexts. The recombinant form of SNX24 allows for the detailed study of its structural and functional properties, enabling researchers to understand how this protein interacts with other cellular machinery. By producing SNX24 in a recombinant form, scientists can investigate its mechanisms of action, explore its role in disease models, and assess its potential as a biomarker or therapeutic target. This research not only provides insights into the biological functions of SNX24 but also paves the way for development of novel strategies in disease treatment and management.
