Analytical Data
-
Gene name
PTCH
- Application
-
Alternative Names
Protein patched homolog 1. PTC. PTC1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13635
-
Expression Region
1-183 aa
-
AA Sequence
MGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANLETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALLQHLDSALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKLQSGTAYLL
-
Molecular Weight
47.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PTCH (Patched) is a key receptor in the Hedgehog signaling pathway, which plays a critical role in various developmental processes and tissue homeostasis. Mutations in the PTCH gene are associated with several types of cancers, including basal cell carcinoma and medulloblastoma, highlighting its importance as a tumor suppressor. In recent years, the focus on PTCH has increased due to its potential as a therapeutic target in cancer treatment. Researchers have been investigating the structure and function of PTCH and its interactions with Hedgehog ligands, leading to insights into the molecular mechanisms underlying signaling regulation. Recombinant PTCH proteins are being produced to facilitate these studies, allowing for detailed analyses of PTCH's role in signal transduction and its implications in cancer biology. The availability of PTCH recombinant proteins has opened avenues for drug discovery, enabling high-throughput screening of small molecules that can modulate this pathway. Overall, the study of PTCH and its recombinant forms continues to be a pivotal area of research, providing valuable information for the development of innovative cancer therapies based on the modulation of the Hedgehog signaling pathway.
