Analytical Data
-
Gene name
RORC
- Application
-
Alternative Names
RORC;NR1F3;RORG;RZRG;Nuclear receptor ROR-gamma
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P51449
-
Expression Region
1-518aa
-
AA Sequence
MDRAPQRQHRASRELLAAKKTHTSQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRNRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASGSGPSYSNNLAKAGLNGASCHLEYSPERGKAEGRESFYSTGSQLTPDRCGLRFEEHRHPGLGELGQGPDSYGSPSFRSTPEAPYASLTEIEHLVQSVCKSYRETCQLRLEDLLRQRSNIFSREEVTGYQRKSMWEMWERCAHHLTEAIQYVVEFAKRLSGFMELCQNDQIVLLKAGAMEVVLVRMCRAYNADNRTVFFEGKYGGMELFRALGCSELISSIFDFSHSLSALHFSEDEIALYTALVLINAHRPGLQEKRKVEQLQYNLELAFHHHLCKTHRQSILAKLPPKGKLRSLCSQHVERLQIFQHLHPIVVQAAFPPLYKELFSTETESPVGLSK
-
Molecular Weight
74.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Research on RORC (Retinoic Acid Receptor-Related Orphan Receptor C) recombinant proteins has garnered significant attention in the fields of immunology and molecular biology due to RORC's pivotal role in the regulation of immune responses and the differentiation of T-helper 17 (Th17) cells. Th17 cells are crucial for the defense against certain pathogens, but their dysregulation is linked to various autoimmune diseases, such as multiple sclerosis and rheumatoid arthritis. Understanding RORC's function is vital for developing therapeutic strategies aimed at modulating immune responses. Recombinant proteins of RORC allow researchers to study its structure, function, and interactions with other molecules in detail. By producing RORC in a laboratory setting, scientists can investigate its regulatory mechanisms, explore its involvement in various signaling pathways, and potentially identify new drug targets for treating immune-related disorders. Recent advancements in protein engineering and expression systems have improved the yield and functionality of these recombinant proteins, facilitating their use in both in vitro and in vivo studies. As a result, the exploration of RORC recombinant proteins represents a promising avenue for enhancing our understanding of immune regulation and advancing therapeutic interventions in autoimmune diseases.











