Cat: PA1000-5163

Recombinant Human MPZ Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    MPZ

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    MPZ;Myelin Protein P0

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P25189

  • Expression Region

    30-156aa

  • AA Sequence

    IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV

  • Molecular Weight

    46.0 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

MPZ (myelin protein zero) is a key structural protein in the peripheral nervous system, primarily involved in the formation and maintenance of myelin sheaths around neuronal axons. Its significance is underscored by its role in myelination, which is crucial for the proper functioning of the nervous system. Abnormalities in MPZ expression or function are linked to various neuropathies, particularly Charcot-Marie-Tooth disease (CMT), a hereditary condition characterized by progressive weakness and atrophy of the limbs. Research into MPZ recombinant proteins seeks to explore their structural and functional properties, providing insights into myelination processes and potential therapeutic approaches for demyelinating diseases. By engineering MPZ variants, scientists aim to understand the protein's interactions with other myelin components and identify the mechanisms underlying myelin sheath assembly. Additionally, the development of MPZ-based therapies holds promise for regenerative medicine and neuroprotection, as elucidating MPZ functionality could pave the way for innovative treatments targeting myelin repair in peripheral neuropathies. As such, MPZ recombinant protein research is not only vital for basic scientific understanding but also for developing clinical applications that may enhance the quality of life for individuals affected by myelin-related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US