Analytical Data
-
Gene name
MPZ
- Application
-
Alternative Names
MPZ；Myelin Protein P0
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P25189
-
Expression Region
30-156aa
-
AA Sequence
IVVYTDREVHGAVGSRVTLHCSFWSSEWVSDDISFTWRYQPEGGRDAISIFHYAKGQPYIDEVGTFKERIQWVGDPRWKDGSIVIHNLDYSDNGTFTCDVKNPPDIVGKTSQVTLYVFEKVPTRYGV
-
Molecular Weight
46.0 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
MPZ (myelin protein zero) is a key structural protein in the peripheral nervous system, primarily involved in the formation and maintenance of myelin sheaths around neuronal axons. Its significance is underscored by its role in myelination, which is crucial for the proper functioning of the nervous system. Abnormalities in MPZ expression or function are linked to various neuropathies, particularly Charcot-Marie-Tooth disease (CMT), a hereditary condition characterized by progressive weakness and atrophy of the limbs. Research into MPZ recombinant proteins seeks to explore their structural and functional properties, providing insights into myelination processes and potential therapeutic approaches for demyelinating diseases. By engineering MPZ variants, scientists aim to understand the protein's interactions with other myelin components and identify the mechanisms underlying myelin sheath assembly. Additionally, the development of MPZ-based therapies holds promise for regenerative medicine and neuroprotection, as elucidating MPZ functionality could pave the way for innovative treatments targeting myelin repair in peripheral neuropathies. As such, MPZ recombinant protein research is not only vital for basic scientific understanding but also for developing clinical applications that may enhance the quality of life for individuals affected by myelin-related disorders.
