Analytical Data
-
Gene name
ROPN1B
- Application
-
Alternative Names
ROPN1B；Ropporin-1B
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9BZX4
-
Expression Region
1-120aa
-
AA Sequence
MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE
-
Molecular Weight
15.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ROPN1B, a member of the ROP (Rho of Plants) protein family, has garnered attention in recent years due to its potential roles in a variety of cellular processes, including cell signaling, cytoskeletal dynamics, and developmental regulation. Initially identified in plants, the presence of ROPN1B in other organisms has suggested that it might be critical for not only plant development but also for diverse biological functions in more complex organisms. Recent studies indicate that ROPN1B may be involved in maintaining cell integrity, regulating cellular responses to stress, and influencing cell division. Its expression patterns raise intriguing questions about its function in both normal physiological processes and in disease states, such as cancer. Understanding the molecular mechanisms underlying ROPN1B's function could offer new insights into cell biology and potential therapeutic targets. Thus, the research on ROPN1B recombinant protein aims to elucidate its functional properties and interactions, using biochemical assays and structural biology techniques. Overall, this line of inquiry is critical for expanding our knowledge of ROP proteins and may pave the way for novel applications in biotechnology and medicine.
