Analytical Data
-
Gene name
C14orf48
- Application
-
Alternative Names
CCDC197; C14orf48; LINC00521Uncharacterized Protein CCDC197; Coiled-coil domain-containing Protein 197
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8NCU1
-
Expression Region
1-140aa
-
AA Sequence
MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYLIKVLEKIPEGCTGWEEPEEVLVEATVKHYGKLFTASQDTQKRLEAFCQMIQAVHRSLESLEEDHRALIASRSGCVSCRRSATASRSSGGS
-
Molecular Weight
42.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf48, also known as "Chromosome 14 Open Reading Frame 48," is a gene located on chromosome 14 that encodes a protein with poorly understood biological functions. Recent studies have suggested its potential role in various cellular processes, including cell proliferation, apoptosis, and response to stress, making it a candidate for further investigation in disease mechanisms. The research on C14orf48 has gained momentum due to its potential implications in cancer biology, where altered expression of this protein could influence tumor progression and response to therapy. Initial findings indicate that C14orf48 may interact with essential signaling pathways, underscoring its relevance in regulating cell fate decisions. To better understand its functions and therapeutic potential, researchers are focusing on producing and characterizing recombinant C14orf48 protein. This recombinant protein allows for detailed studies of its biochemical properties, interactions with other cellular molecules, and effects on cellular behavior. Investigating C14orf48 at the protein level will provide insights into its functional roles and contributions to disease, ultimately aiding in the development of targeted therapies. Overall, continued research on C14orf48 is essential to elucidate its role in health and disease, particularly as a potential biomarker or therapeutic target in oncology and other fields.
