Analytical Data
-
Gene name
PRKRIR
- Application
-
Alternative Names
PRKRIR;DAP4;P52RIPK;PRKRIR;52 kDa repressor of the inhibitor of the Protein kinase
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O43422
-
Expression Region
612-761aa
-
AA Sequence
MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT
-
Molecular Weight
33.6 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRKRIR, or Protein Regulator of Interferon Regulatory Factor, has gained attention in recent years due to its role in the immune response and its potential implications in various diseases, including cancer and autoimmune disorders. Research indicates that PRKRIR functions as a crucial modulator of the interferon signaling pathway, which is vital for the regulation of antiviral responses and the maintenance of immune homeostasis. The protein is known to interact with key signaling molecules, influencing the activation and expression of interferon-stimulated genes. Given its involvement in immune regulation, PRKRIR has emerged as a candidate for therapeutic intervention. Scientists are exploring its potential as a biomarker for disease progression and treatment response, particularly in conditions where interferon signaling is dysregulated. The ability to produce recombinant PRKRIR has facilitated the detailed study of its structure-function relationships, cellular interactions, and potential as a therapeutic target. As research continues to unravel the complexities of PRKRIR's role in the immune system, it holds promise for novel treatment strategies and a deeper understanding of host-pathogen interactions. This underscores the importance of PRKRIR in both fundamental immunology and its potential clinical applications, making it a compelling focus for ongoing and future investigations in the field.











