Analytical Data
-
Gene name
PRIM1
- Application
-
Alternative Names
PRIM1；DNA primase small subunit
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P49642
-
Expression Region
1-420aa
-
AA Sequence
METFDPTELPELLKLYYRRLFPYSQYYRWLNYGGVIKNYFQHREFSFTLKDDIYIRYQSFNNQSDLEKEMQKMNPYKIDIGAVYSHRPNQHNTVKLGAFQAQEKELVFDIDMTDYDDVRRCCSSADICPKCWTLMTMAIRIIDRALKEDFGFKHRLWVYSGRRGVHCWVCDESVRKLSSAVRSGIVEYLSLVKGGQDVKKKVHLSEKIHPFIRKSINIIKKYFEEYALVNQDILENKESWDKILALVPETIHDELQQSFQKSHNSLQRWEHLKKVASRYQNNIKNDKYGPWLEWEIMLQYCFPRLDINVSKGINHLLKSPFSVHPKTGRISVPIDLQKVDQFDPFTVPTISFICRELDAISTNEEEKEENEAESDVKHRTRDYKKTSLAPYVKVFEHFLENLDKSRKGELLKKSDLQKDF
-
Molecular Weight
65.9 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRIM1, or DNA Primase Subunit 1, is a key enzyme involved in DNA replication, specifically responsible for synthesizing short RNA primers necessary for the initiation of DNA synthesis. This protein is crucial for the accurate duplication of the genome, and its function is vital in both prokaryotic and eukaryotic organisms. Research on PRIM1 has gained significance due to its implications in understanding cellular processes associated with DNA replication and repair mechanisms. Abnormalities in PRIM1 function can lead to genomic instability, which is a hallmark of various diseases, including cancer. Consequently, the study of PRIM1 recombinant protein provides valuable insights into its structural and functional properties, along with its interactions with other proteins involved in the replication machinery. Furthermore, recombinant PRIM1 can be utilized in biochemical assays and drug discovery platforms to identify potential inhibitors that may selectively target the replication process in cancer cells. As researchers continue to explore the role of PRIM1 in cellular integrity and disease, understanding its biochemical characteristics and interaction networks could facilitate the development of novel therapeutic strategies aimed at mitigating the effects of replication errors in tumors and other related pathologies.
