Analytical Data
-
Gene name
C14orf24
- Application
-
Alternative Names
Protein FAM177A1
-
Species
Human
-
Source
E. coli
-
Tag
GST-tag at N-terminal
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q8N128
-
Expression Region
1-213 aa
-
AA Sequence
MDQEPVGGVERGEAVAASGAAAAAAFGESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGLEKKDVLPTVDPTKLTWGPYLWFYMLRAATSTLSVCDFLGEKIASVLGISTPKYQYAIDEYYRMKKEEEEEEEENRMSEEAEKQYQQNKLQTDSIVQTDQPETVISSSFVNVNFEMEGDSEVIMESKQNPVSVPP
-
Molecular Weight
50.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
C14orf24, a gene located on chromosome 14, has garnered increasing attention in recent years due to its potential implications in various biological processes and disease mechanisms. Initially identified through genomic approaches, C14orf24 encodes a protein that is believed to play a role in cellular functions such as proliferation, differentiation, and apoptosis. Research indicates that alterations in C14orf24 expression may be associated with developmental disorders and certain malignancies, highlighting its importance in health and disease. Moreover, the protein's structural characteristics and interaction with other cellular components are being investigated to elucidate its biological functions further. The development of recombinant C14orf24 protein allows for detailed studies of its biochemical properties and functional assays, paving the way for understanding its role in signaling pathways and cellular interactions. Consequently, investigating C14orf24 could not only provide insights into fundamental cellular biology but also offer potential therapeutic targets for diseases linked to its dysregulation. Overall, the growing body of research surrounding C14orf24 underscores its significance in both basic and translational science.
