Analytical Data
-
Gene name
PRMT8
- Application
-
Alternative Names
ANM8_HUMAN; Heterogeneous nuclear ribonucleoprotein methyltransferase like protein 4 ; Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 4; HMT1 hnRNP methyltransferase like 3; HMT1 hnRNP methyltransferase like 4; HRMT1 L3; HRMT1 L4; HRMT1L 3; HRMT1L 4; HRMT1L3; HRMT1L4; prmt8; Protein arginine N methyltransferase 4; Protein arginine N methyltransferase 8; Protein arginine N-methyltransferase 8
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NR22
-
Expression Region
61-394 aa
-
AA Sequence
MSKLLNPEEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSMFAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWMGYCLFYESMLNTVIFARDKWLKPGGLMFPDRAALYVVAIEDRQYKDFKIHWWENVYGFDMTCIRDVAMKEPLVDIVDPKQVVTNACLIKEVDIYTVKTEELSFTSAFCLQIQRNDYVHALVTYFNIEFTKCHKKMGFSTAPDAPYTHWKQTVFYLEDYLTVRRGEEIYGTISMKPNAKNVRDLDFTVDLDFKGQLCETSVSNDYKMR
-
Molecular Weight
45.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
PRMT8, an enzyme belonging to the protein arginine methyltransferase family, plays a crucial role in post-translational modification by catalyzing the methylation of arginine residues in various proteins. This modification is essential for numerous cellular processes, including gene expression, signal transduction, and RNA processing. Emerging studies suggest that PRMT8 is particularly important in the nervous system, where it influences neuronal differentiation, synaptic function, and neuronal plasticity. Abnormal PRMT8 activity has been implicated in various neurological disorders, making it a potential target for therapeutic intervention. The development of recombinant PRMT8 protein offers a valuable tool for studying its biochemical properties, substrate specificity, and functional roles in cellular systems. By utilizing recombinant techniques, researchers can produce high-purity PRMT8 for in vitro assays, enabling them to investigate the molecular mechanisms underlying its methyltransferase activity and its impact on neuronal functions. Furthermore, understanding PRMT8's interaction with other proteins and its contribution to disease pathways may provide insights into novel strategies for treating conditions associated with its dysregulation. Thus, the study of recombinant PRMT8 protein promises to enhance our comprehension of arginine methylation and its significance in health and disease.
