Analytical Data
-
Gene name
ODAM
- Application
-
Alternative Names
ODAM；APIN；Odontogenic ameloblast-associated Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
A1E959
-
Expression Region
16-279aa
-
AA Sequence
APLIPQRLMSASNSNELLLNLNNGQLLPLQLQGPLNSWIPPFSGILQQQQQAQIPGLSQFSLSALDQFAGLLPNQIPLTGEASFAQGAQAGQVDPLQLQTPPQTQPGPSHVMPYVFSFKMPQEQGQMFQYYPVYMVLPWEQPQQTVPRSPQQTRQQQYEEQIPFYAQFGYIPQLAEPAISGGQQQLAFDPQLGTAPEIAVMSTGEEIPYLQKEAINFRHDSAGVFMPSTSPKPSTTNVFTSAVDQTITPELPEEKDKTDSLREP
-
Molecular Weight
33.2 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ODAM (Oligodendrocyte Differentiation-Associated Modulator) is a protein that is integral to the development and functionality of oligodendrocytes, the myelinating cells of the central nervous system. Research into ODAM has gained traction due to its significant role in neuronal health and myelin sheath formation, which are crucial for efficient nerve signal transmission. Dysregulation of ODAM has been implicated in various neurodegenerative diseases, including Multiple Sclerosis and Alzheimer's disease, where myelin damage and neuronal loss are prevalent. Understanding the molecular mechanisms governing ODAM's functions could provide insights into myelin repair processes and potential therapeutic targets for demyelinating conditions. The exploration of ODAM-associated pathways also promises to enhance our comprehension of oligodendrocyte biology and its interactions with neurons, thereby identifying novel strategies to promote remyelination and improve neurological outcomes. As the research landscape evolves, studies focus on the potential of recombinant ODAM protein for experimental applications, which could lead to breakthroughs in regenerative medicine and neuroprotection.
