Cat: PA1000-5031

Recombinant Human ETS1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ETS1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ETS1;EWSR2;Protein C-ets-1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96AC5

  • Expression Region

    1-272aa

  • AA Sequence

    MGSSHHHHHHSSGLVPRGSHMKAAVDLKPTLTIIKTEKVDLELFPSPDME CADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDW VMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLE ILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSF ITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEV VTPDNMCMGRTSRGKLGGQDSFESIESYDSCGQEMGKEEKQT

  • Molecular Weight

    33 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ETS1 is a transcription factor belonging to the ETS (E26 transformation-specific) family, which plays a crucial role in various biological processes, including cell proliferation, differentiation, and apoptosis. Its dysfunction is associated with several diseases, particularly cancer, making it a significant target for therapeutic research. The ETS1 protein contains a highly conserved DNA-binding domain that enables it to regulate gene expression by binding to specific promoter regions. Recent studies have indicated that ETS1 not only influences tumor progression but also modulates the immune response, highlighting its importance in both cancer biology and immunology. Given the complexity of ETS1's regulatory mechanisms, researchers have focused on the structural and functional characterization of ETS1 recombinant proteins to elucidate its interactions with other proteins and nucleic acids. This research involves various techniques, such as protein crystallography and binding assays, to determine the three-dimensional structure of ETS1, providing insights into its function in vivo. Understanding the biological role and interactions of ETS1 is pivotal for developing targeted therapies, as it offers opportunities to manipulate its activity in disease contexts. Overall, the study of ETS1 recombinant proteins is essential for unraveling the molecular underpinnings of its function and exploring its potential as a biomarker or therapeutic target in oncology and immunology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US