Cat: PA2000-2136

Recombinant Human NRL Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NRL

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NRL;D14S46E;Neural retina-specific leucine zipper Protein

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P54845

  • Expression Region

    1-237aa

  • AA Sequence

    MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL

  • Molecular Weight

    33.4 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NRL (Neural Retina Leucine Zipper) is a crucial transcription factor primarily expressed in photoreceptor cells of the retina, playing a pivotal role in the development and maintenance of these cells. Research into NRL and its associated recombinant proteins has gained momentum due to its implications in retinal degenerative diseases, such as retinitis pigmentosa and age-related macular degeneration, where the loss of photoreceptors leads to severe vision impairment. Understanding the molecular mechanisms of NRL function and its interactions with other transcriptional regulators not only provides insights into photoreceptor development but also opens avenues for potential therapeutic strategies targeting retinal diseases. Recombinant NRL proteins can be utilized in various experimental models to elucidate its role in photoreceptor differentiation, cellular signaling pathways, and gene expression regulation. Additionally, the study of NRL's structure-function relationship may help in the design of novel gene therapies or small molecules aimed at modulating its activity, thereby offering hope for restoring vision in affected individuals. As a result, the investigation of NRL and its recombinant proteins positions itself at the intersection of developmental biology, genetics, and therapeutic innovation, underscoring its significance in the quest to combat visual impairments stemming from retinal cell dysfunction.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US