Analytical Data
-
Gene name
NRL
- Application
-
Alternative Names
NRL；D14S46E；Neural retina-specific leucine zipper Protein
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P54845
-
Expression Region
1-237aa
-
AA Sequence
MALPPSPLAMEYVNDFDLMKFEVKREPSEGRPGPPTASLGSTPYSSVPPSPTFSEPGMVGATEGTRPGLEELYWLATLQQQLGAGEALGLSPEEAMELLQGQGPVPVDGPHGYYPGSPEETGAQHVQLAERFSDAALVSMSVRELNRQLRGCGRDEALRLKQRRRTLKNRGYAQACRSKRLQQRRGLEAERARLAAQLDALRAEVARLARERDLYKARCDRLTSSGPGSGDPSHLFL
-
Molecular Weight
33.4 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NRL (Neural Retina Leucine Zipper) is a crucial transcription factor primarily expressed in photoreceptor cells of the retina, playing a pivotal role in the development and maintenance of these cells. Research into NRL and its associated recombinant proteins has gained momentum due to its implications in retinal degenerative diseases, such as retinitis pigmentosa and age-related macular degeneration, where the loss of photoreceptors leads to severe vision impairment. Understanding the molecular mechanisms of NRL function and its interactions with other transcriptional regulators not only provides insights into photoreceptor development but also opens avenues for potential therapeutic strategies targeting retinal diseases. Recombinant NRL proteins can be utilized in various experimental models to elucidate its role in photoreceptor differentiation, cellular signaling pathways, and gene expression regulation. Additionally, the study of NRL's structure-function relationship may help in the design of novel gene therapies or small molecules aimed at modulating its activity, thereby offering hope for restoring vision in affected individuals. As a result, the investigation of NRL and its recombinant proteins positions itself at the intersection of developmental biology, genetics, and therapeutic innovation, underscoring its significance in the quest to combat visual impairments stemming from retinal cell dysfunction.
