Analytical Data
-
Gene name
ZBED1
- Application
-
Alternative Names
ZBED1；ALTE；DREF；hDREF；E3 SUMO-Protein ligase ZBED1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O96006
-
Expression Region
3-100aa
-
AA Sequence
NKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMA QIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPE
-
Molecular Weight
11 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZBED1, a member of the zinc finger protein family, is a transcription factor that plays a crucial role in various biological processes, including cell differentiation, development, and stress responses. It has garnered significant attention in recent years due to its involvement in the regulation of gene expression associated with cell growth and proliferation. The study of ZBED1-recombinant protein aims to elucidate its functional mechanisms and interactions within cellular pathways, making it a valuable model for understanding complex regulatory networks. Researchers have utilized recombinant DNA technology to produce ZBED1 proteins, facilitating in vitro studies that help unravel its role in transcriptional regulation. Furthermore, ZBED1 is implicated in several diseases, including cancer, where its expression levels can influence tumor progression and metastasis. Therefore, characterizing ZBED1 through recombinant protein studies offers insights into its potential as a diagnostic marker and therapeutic target, highlighting its relevance in both basic and applied research contexts. Understanding the structure-function relationship of ZBED1 is essential for developing strategies to manipulate its activity for clinical applications, emphasizing the importance of this protein in molecular biology and medicine.
