Analytical Data
-
Gene name
SULT1A3
- Application
-
Alternative Names
SULT1A3;STM;Sulfotransferase 1A3
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P0DMM9
-
Expression Region
1-295aa
-
AA Sequence
MELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLINTYPKSGTTWVSQILDMIYQGGDLEKCNRAPIYVRVPFLEVNDPGEPSGLETLKDTPPPRLIKSHLPLALLPQTLLDQKVKVVYVARNPKDVAVSYYHFHRMEKAHPEPGTWDSFLEKFMAGEVSYGSWYQHVQEWWELSRTHPVLYLFYEDMKENPKREIQKILEFVGRSLPEETMDFMVQHTSFKEMKKNPMTNYTTVPQELMDHSISPFMRKGMAGDWKTTFTVAQNERFDADYAEKMAGCSLSFRSEL
-
Molecular Weight
50.2kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
SULT1A3, or sulfotransferase family 1A member 3, is an important enzyme involved in the sulfonation of various endogenous and exogenous compounds, which plays a crucial role in the metabolism and detoxification processes in the human body. This enzyme is particularly significant in the biotransformation of catecholamines, steroids, and certain drugs, impacting their pharmacokinetics and biological activity. Research has shown that variations in SULT1A3 expression can influence individual drug responses and the susceptibility to certain diseases, making it a vital target for pharmacogenomic studies. The recombinant form of SULT1A3 produced through molecular cloning techniques enables detailed enzymatic studies and provides insights into its substrate specificity, kinetic parameters, and regulatory mechanisms. Furthermore, understanding the structure-function relationship of SULT1A3 through recombinant protein studies can lead to the development of novel therapeutics and personalized medicine approaches, addressing the variability in drug metabolism among different individuals. This makes SULT1A3 a focal point of research in pharmacology, toxicology, and metabolic disease studies.











