Cat: PA1000-4974

Recombinant Human ZBTB9 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ZBTB9

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ZBTB9;Zinc finger and BTB domain-containing Protein 9

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q96C00

  • Expression Region

    1-473aa

  • AA Sequence

    METPTPLPPVPASPTCNPAPRTIQIEFPQHSSSLLESLNRHRLEGKFCDV SLLVQGRELRAHKAVLAAASPYFHDKLLLGDAPRLTLPSVIEADAFEGLL QLIYSGRLRLPLDALPAHLLVASGLQMWQVVDQCSEILRELETSGGGISA RGGNSYHALLSTTSSTGGWCIRSSPFQTPVQSSASTESPASTESPVGGEG SELGEVLQIQVEEEEEEEEDDDDEDQGSATLSQTPQPQRVSGVFPRPHGP HPLPMTATPRKLPEGESAPLELPAPPALPPKIFYIKQEPFEPKEEISGSG TQPGGAKEETKVFSGGDTEGNGELGFLLPSGPGPTSGGGGPSWKPVDLHG NEILSGGGGPGGAGQAVHGPVKLGGTPPADGKRFGCLCGKRFAVKPKRDR HIMLTFSLRPFGCGICNKRFKLKHHLTEHMKTHAGALHACPHCGRRFRVH ACFLRHRDLCKGQGWATAHWTYKLEHHHHHH

  • Molecular Weight

    52 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ZBTB9 (Zinc Finger and BTB Domain Containing 9) is a member of the BTB-ZF protein family, which plays a critical role in various biological processes, including transcriptional regulation and chromatin remodeling. Research has shown that ZBTB9 is involved in vital cellular functions such as cell proliferation, differentiation, and apoptosis. Given its potential implications in cancer and other diseases, understanding the structure and function of ZBTB9 is essential for therapeutic development. The demand for ZBTB9 recombinant protein arises from the need to study its molecular interactions and functions in detail. Producing ZBTB9 as a recombinant protein allows researchers to analyze its binding properties, post-translational modifications, and role in gene regulation in a controlled environment. Furthermore, this protein can be used in functional assays to ascertain its biological activities and potential as a therapeutic target. Consequently, the investigation of ZBTB9 recombinant protein aids in the elucidation of its mechanism of action and the exploration of its relevance in health and disease, paving the way for novel interventions in pathologies linked to its dysfunction. As the scientific community seeks to better understand the complexities of gene regulation, ZBTB9 stands out as a promising candidate for understanding new layers of regulatory networks and developing innovative treatments.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US