Cat: PA2000-2118

Recombinant Human NDUFA6 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    NDUFA6

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    NDUFA6;LYRM6;NADHB14;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P56556

  • Expression Region

    1-128 aa

  • AA Sequence

    MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP

  • Molecular Weight

    42.1 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

NDUFA6, a subunit of the mitochondrial NADH:ubiquinone oxidoreductase (Complex I), plays a crucial role in the electron transport chain, facilitating oxidative phosphorylation and ATP production in eukaryotic cells. Mutations in the NDUFA6 gene have been implicated in various mitochondrial disorders, leading to severe metabolic dysregulation and neurological deficits due to impaired energy production. The study of recombinant NDUFA6 protein is essential for understanding its structural and functional properties, particularly its interactions within the larger Complex I assembly. This research not only helps elucidate the molecular mechanisms underpinning mitochondrial dysfunction but also aids in the development of targeted therapies for patients suffering from Complex I-related diseases. Recombinant protein studies can offer insights into the effects of specific mutations and contribute to the understanding of protein folding, stability, and activity in the context of the entire respiratory chain. Furthermore, these studies pave the way for potential therapeutic strategies, including gene therapy and pharmacological interventions, aimed at restoring proper mitochondrial function and alleviating the symptoms associated with mitochondrial diseases. The advancement in recombinant DNA technology has facilitated the production and purification of NDUFA6, enabling detailed biochemical and biophysical characterization, which is critical for advancing our knowledge of mitochondrial biology and pathology.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US