Analytical Data
-
Gene name
NDUFA6
- Application
-
Alternative Names
NDUFA6；LYRM6；NADHB14；NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P56556
-
Expression Region
1-128 aa
-
AA Sequence
MAGSGVRQATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP
-
Molecular Weight
42.1 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
NDUFA6, a subunit of the mitochondrial NADH:ubiquinone oxidoreductase (Complex I), plays a crucial role in the electron transport chain, facilitating oxidative phosphorylation and ATP production in eukaryotic cells. Mutations in the NDUFA6 gene have been implicated in various mitochondrial disorders, leading to severe metabolic dysregulation and neurological deficits due to impaired energy production. The study of recombinant NDUFA6 protein is essential for understanding its structural and functional properties, particularly its interactions within the larger Complex I assembly. This research not only helps elucidate the molecular mechanisms underpinning mitochondrial dysfunction but also aids in the development of targeted therapies for patients suffering from Complex I-related diseases. Recombinant protein studies can offer insights into the effects of specific mutations and contribute to the understanding of protein folding, stability, and activity in the context of the entire respiratory chain. Furthermore, these studies pave the way for potential therapeutic strategies, including gene therapy and pharmacological interventions, aimed at restoring proper mitochondrial function and alleviating the symptoms associated with mitochondrial diseases. The advancement in recombinant DNA technology has facilitated the production and purification of NDUFA6, enabling detailed biochemical and biophysical characterization, which is critical for advancing our knowledge of mitochondrial biology and pathology.
