Analytical Data
-
Gene name
ZBTB17
- Application
-
Alternative Names
ZBTB17；MIZ1；ZNF151；ZNF60；Zinc finger and BTB domain-containing Protein 17
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q13105
-
Expression Region
1-188aa
-
AA Sequence
MGSSHHHHHHSSGLVPRGSHMDFPQHSQHVLEQLNQQRQLGLLCDCTFVV DGVHFKAHKAVLAACSEYFKMLFVDQKDVVHLDISNAAGLGQVLEFMYTA KLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATSPGGNAEALAT EGGDKRAKEEKVATSTLSRLEQAGRSTPIGPSRDLKEERGGQAQSAASGA EQTEKADA
-
Molecular Weight
22 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ZBTB17, a member of the zinc finger and BTB domain-containing protein family, plays a crucial role in various biological processes, including gene regulation, immune response, and cellular differentiation. Its involvement in transcriptional regulation has garnered attention in the context of cancer research, as alterations in its expression and function may contribute to tumorigenesis and the progression of various malignancies. The study of ZBTB17 as a recombinant protein aims to elucidate its structural and functional characteristics, facilitating the understanding of its biological roles and interactions. The recombinant form allows for detailed analysis in vitro, providing insights into its mechanisms of action and potential therapeutic applications. Additionally, understanding ZBTB17's role in immune system modulation may offer new approaches to enhance immune responses in cancer therapy or autoimmune diseases. Harnessing the properties of ZBTB17 could lead to innovative strategies for drug design and development, making it a focus of ongoing research in both molecular biology and clinical settings. Overall, the exploration of ZBTB17 recombinant protein serves as a gateway to deeper insights into its functional dynamics and significance in health and disease.
