Cat: PA1000-4933

Recombinant Human IL-7 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    IL-7

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    IL-7;Interleukin-7

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P13232

  • Expression Region

    26-177aa

  • AA Sequence

    DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDAN KEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRK PAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTK EH

  • Molecular Weight

    17 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

Interleukin-7 (IL-7) is a crucial cytokine that plays a significant role in the development and homeostasis of T and B lymphocytes, making it a key player in the immune system. Its functions are primarily mediated through the IL-7 receptor (IL-7R), and it is essential for lymphocyte survival, proliferation, and differentiation. Research on recombinant IL-7 proteins has gained momentum due to their potential therapeutic applications in various immunological disorders, including autoimmune diseases, cancer, and immunodeficiencies. The ability of IL-7 to enhance T-cell responses makes it a promising candidate for cancer immunotherapy and vaccine development, particularly in enhancing the immune system's ability to recognize and combat tumors. Additionally, recombinant IL-7 has shown promise in restoring immune function in individuals with HIV and in improving the efficacy of treatments for hematological malignancies. Studies have focused on optimizing recombinant protein production, enhancing stability, and evaluating its biological activity in preclinical and clinical settings. The ongoing exploration of IL-7's role in immune regulation and its therapeutic potential underscores the importance of this cytokine in advancing immunological research and developing novel treatment strategies for various diseases.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US