Analytical Data
-
Gene name
LY6G6D
- Application
-
Alternative Names
LY6G6D；C6orf21；G6F；LY6G6D；Lymphocyte antigen 6 complex locus Protein G6f
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
O95868
-
Expression Region
20-104aa
-
AA Sequence
NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHP ACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
-
Molecular Weight
26 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
LY6G6D is a member of the LY6 family of proteins, characterized by a glycosylphosphatidylinositol (GPI) anchor that facilitates its membrane localization. This protein has garnered significant interest in immunology and cancer research due to its potential role in modulating immune responses and influencing tumor progression. Studies suggest that LY6G6D may be involved in regulating T cell activation and differentiation, highlighting its importance in maintaining immune homeostasis. Additionally, aberrant expression of LY6G6D has been linked to various malignancies, prompting investigations into its utility as a biomarker for cancer diagnosis and prognosis. Understanding the precise mechanisms by which LY6G6D exerts its effects on immune cells and tumor biology could open new avenues for therapeutic interventions in cancer and autoimmune diseases. Research into LY6G6D is still in its early stages, yet the emerging data underscore its significance within the LY6 family, suggesting that further exploration could yield valuable insights into its function and relevance in health and disease.
