Cat: PA2000-2084

Recombinant Human LY6G6D Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    LY6G6D

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    LY6G6D;C6orf21;G6F;LY6G6D;Lymphocyte antigen 6 complex locus Protein G6f

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    O95868

  • Expression Region

    20-104aa

  • AA Sequence

    NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHP ACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

  • Molecular Weight

    26 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

LY6G6D is a member of the LY6 family of proteins, characterized by a glycosylphosphatidylinositol (GPI) anchor that facilitates its membrane localization. This protein has garnered significant interest in immunology and cancer research due to its potential role in modulating immune responses and influencing tumor progression. Studies suggest that LY6G6D may be involved in regulating T cell activation and differentiation, highlighting its importance in maintaining immune homeostasis. Additionally, aberrant expression of LY6G6D has been linked to various malignancies, prompting investigations into its utility as a biomarker for cancer diagnosis and prognosis. Understanding the precise mechanisms by which LY6G6D exerts its effects on immune cells and tumor biology could open new avenues for therapeutic interventions in cancer and autoimmune diseases. Research into LY6G6D is still in its early stages, yet the emerging data underscore its significance within the LY6 family, suggesting that further exploration could yield valuable insights into its function and relevance in health and disease.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US