Analytical Data
-
Gene name
IL-20
- Application
-
Alternative Names
IL-20；ZCYTO10；Interleukin-20
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q9NYY1
-
Expression Region
25-176aa
-
AA Sequence
LKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDT KPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLR LCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEE TE
-
Molecular Weight
17 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Interleukin-20 (IL-20) is a cytokine that plays a significant role in the regulation of immune responses and inflammation. It belongs to the IL-10 family and primarily acts on skin and mucosal tissues, influencing the pathogenesis of various dermatological conditions, including psoriasis. Research has indicated that IL-20 contributes to the proliferation and differentiation of keratinocytes, promoting inflammatory responses and skin barrier dysfunction. Given its pivotal role in inflammatory diseases, targeting IL-20 signaling pathways holds potential therapeutic implications. Recent studies on IL-20 recombinant protein have focused on understanding its structural properties and biological functions, exploring its potential as a therapeutic agent in treating skin disorders. Additionally, recombinant IL-20 is being investigated for its role in modulating immune responses in other conditions, including autoimmune diseases and infections. The recombinant production of IL-20 enables the study of its effects in vitro and in vivo, facilitating the exploration of its therapeutic applications and mechanisms of action. Overall, the research surrounding IL-20 recombinant protein underscores its importance in immunology and dermatology, paving the way for novel treatment strategies.
