Cat: PA1000-4847

Recombinant Human ACTR8 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    ACTR8

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    ACTR8;ARP8;INO80N;Actin-related Protein 8

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    Q9H981-3

  • Expression Region

    1-329aa

  • AA Sequence

    MNHKVMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVE DGVSHRNTRIFSWNQDISGLQDHEFQIRHPDSPALLYQFRLGDEKLQAPM ALFYPATFGIVGQKMTTLQHRSQGDPEDPHDEHYLLATQSKQEQSAKATA DRKSASKPIGFEGDLRGQSSDLPERLHSQEVDLGSAQGDGLMAGNDSEEA LTALMSRKTAISLFEGKALGLDKAILHSIDCCSSDDTKKKMYSSILVVGG GLMFHKAQEFLQHRILNKMPPSFRRIIENVDVITRPKDMDPRLIAWKGGA VLACLDTTQELWIYQREWQ RFGVRMLRERAAFVW

  • Molecular Weight

    38 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

ACTR8, also known as activated Cdc42-associated kinase 8, is a member of the NCK-interacting kinase family that has gained significant attention in cellular and molecular biology research due to its pivotal role in cytoskeletal dynamics and cellular signaling pathways. It is primarily involved in regulating actin filament organization and is implicated in various cellular processes, such as cell migration, adhesion, and morphology. Mutations and alterations in ACTR8 expression levels have been associated with developmental disorders and cancer, highlighting its importance in maintaining cellular homeostasis. Recent studies have focused on understanding the structural characteristics and functional mechanisms of ACTR8, particularly its interactions with GTPases like Cdc42 and its role in the formation of cellular structures like filopodia. Researchers are also investigating the potential of ACTR8 as a therapeutic target, especially in oncology, where its modulation could influence tumor progression and metastasis. As such, the recombinant production of ACTR8 protein has become a critical aspect of research, enabling detailed biochemical assays and structural analyses to decipher the complex regulatory networks it participates in, ultimately advancing our understanding of its biological significance and therapeutic potential.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US