Analytical Data
-
Gene name
ACRV1
- Application
-
Alternative Names
ACRV1;Acrosomal Protein SP-10
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P26436
-
Expression Region
22-265aa
-
AA Sequence
QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSS EHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSG EHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASG EQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKK IFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
-
Molecular Weight
27 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
ACRV1, also known as Acrosomal Protein 1, is a crucial protein that has garnered attention in reproductive biology and fertility research due to its specific expression in the acrosome of spermatozoa. The acrosome is a specialized structure that plays a pivotal role in the fertilization process by aiding sperm in penetrating the zona pellucida of the oocyte. Abnormalities in ACRV1 expression have been linked to male infertility, making it a potential biomarker for assessing sperm quality and functionality. Research efforts have focused on the molecular characterization of ACRV1, including its gene structure, expression patterns, and the signaling pathways involved in its activity during spermatogenesis. Recombinant ACRV1 protein has been produced to facilitate studies on its functional properties and interactions with other reproductive proteins, providing insights into its role in sperm-egg recognition and fusion. Investigating the potential applications of ACRV1 in assisted reproductive technologies is another important avenue of research, as understanding its mechanisms could enhance fertility treatments and improve outcomes for couples facing infertility challenges. Overall, the study of ACRV1 and its recombinant forms represents a promising frontier in reproductive health, highlighting the need for continued exploration of its biological significance and therapeutic potential.











