Analytical Data
-
Gene name
Kcp
- Application
-
Alternative Names
Kcp；KCP2；Keratinocyte-associated Protein 2
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
Q6ZWJ8
-
Expression Region
1084-1478aa
-
AA Sequence
QSCVHQGREVASGERWTVDTCTSCSCMAGTVRCQSQRCSPLSCGPDKAPALSPGSCCPRCLPRPASCMAFGDPHYRTFDGRLLHFQGSCSYVLAKDCHSGDFSVHVTNDDRGRSGVAWTQEVAVLLGDMAVRLLQDGAVTVDGHPVALPFLQEPLLYVELRGHTVILHAQPGLQVLWDGQSQVEVSVPGSYQGRTCGLCGNFNGFAQDDLQGPEGLLLPSEAAFGNSWQVSEGLWPGRPCSAGREVDPCRAAGYRARREANARCGVLKSSPFSRCHAVVPPEPFFAACVYDLCACGPGSSADACLCDALEAYASHCRQAGVTPTWRGPTLCVVGCPLERGFVFDECGPPCPRTCFNQHIPLGELAAHCVRPCVPGCQCPAGLVEHEAHCIPPEAC
-
Molecular Weight
49.5 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
Kcp, a protein involved in various cellular processes, has garnered significant attention in recent years due to its pivotal role in plant and fungal systems. Studies have shown that Kcp is essential for regulating growth, development, and stress responses in these organisms. Its implications extend to agricultural biotechnology, where harnessing Kcp's function could lead to the development of crops with enhanced resilience to environmental stresses such as drought and pathogen attacks. The reorganization of Kcp proteins is particularly intriguing as it has been linked to signal transduction pathways that modulate cellular responses. Recent advancements in molecular techniques, such as CRISPR/Cas9 and high-throughput sequencing, have enabled researchers to delve deeper into Kcp's structural and functional dynamics, allowing them to explore its interactions with other proteins. This research has the potential to unveil new strategies for improving plant yield and managing diseases. Overall, the investigation of Kcp and its restructured variants not only enhances our understanding of fundamental biological processes but also opens up avenues for practical applications in sustainable agriculture.
