Cat: PA2000-2058

Recombinant Human KCNJ1 Protein,His

  • Price
  • Size
  • Number

    Order now. For delivery time, please consult customer service

  • Pre-sale guidance and worry-free after-sale service
  • Quality assurance for cold chain transportation

Analytical Data

  • Gene name

    KCNJ1

  • Application

    SPRMSTBLIITCELISACELL ASSAYDRUG SCREENING

  • Alternative Names

    KCNJ1;ROMK1;ATP-sensitive inward rectifier potassium channel 1

  • Species

    Human

  • Source

    E. coli

  • Tag

    His tag N-Terminus

  • Purity

    Greater than 90% as determined by SDS-PAGE.

  • Uniprot

    P48048

  • Expression Region

    178-391aa

  • AA Sequence

    ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM

  • Molecular Weight

    26.3 kDa

  • Endotoxin

    < 1.0 EU per μg protein as determined by the LAL method.

  • Form

    Freeze-dried powder

  • Buffer formulation

    PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.

  • Reconstitution

    Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.

  • Customization

    Site-directed mutagenesis Custom tag design Custom buffer formulation Custom full-length protein production

  • Stability Test

    The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.

  • Storage & Shelf Life

    Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

  • Shipping

    In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.

Quality inspection process

Related Products

Protein Description

KCNJ1, also known as the renal outer medullary potassium channel (ROMK), is a member of the potassium ion channel family and plays a crucial role in renal physiology, particularly in potassium homeostasis and signal transduction pathways in the kidneys. Mutations in the KCNJ1 gene have been implicated in a rare genetic disorder called Bartter syndrome, characterized by hypokalemia, metabolic alkalosis, and increased renin and aldosterone levels, leading to electrolyte imbalances. The study of KCNJ1 recombinant proteins is essential for understanding the structure-function relationships of this channel, its physiological role in the nephron, and its interactions with various pharmacological agents. Additionally, KCNJ1 is a potential target for drug development aimed at treating conditions related to potassium imbalance and other renal pathologies. Research into its recombinant expression allows for detailed biophysical and biochemical characterization, which is necessary for deciphering the dynamics of ion conduction and the mechanisms underlying its regulation. Understanding how mutations affect KCNJ1 function can also provide insights into the disease mechanisms of Bartter syndrome and guide therapeutic strategies. Therefore, KCNJ1 recombinant proteins serve as a critical tool in both basic and applied research, enhancing our comprehension of kidney function and paving the way for novel treatment options for related disorders.

E-mail

sales@ipodix.com

Sales

+1 2092920560


Contact us via WhatsApp

IPODIX Biotech Inc

2108 N ST, STE N
Sacramento, CA 95816, USA

For Product Information and Orders

sales@ipodix.com

For Business Collaboration

sales@ipodix.com

For CRO Services

sales@ipodix.com

For Technical Support

sales@ipodix.com
  • 50000+

    Recombinant Proteins

  • 100+

    Researchers

  • 100+

    Countries Served

  • ISO

    Certified Quality

Committed to Quality
Driven by Innovation

Learn More About US