Analytical Data
-
Gene name
KCNJ1
- Application
-
Alternative Names
KCNJ1；ROMK1；ATP-sensitive inward rectifier potassium channel 1
-
Species
Human
-
Source
E. coli
-
Tag
His tag N-Terminus
-
Purity
Greater than 90% as determined by SDS-PAGE.
-
Uniprot
P48048
-
Expression Region
178-391aa
-
AA Sequence
ILAKISRPKKRAKTITFSKNAVISKRGGKLCLLIRVANLRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVLWGYRFAPIVSKTKEGKYRVDFHNFSKTVEVETPHCAMCLYNEKDVRARMKRGYDNPNFILSEVNETDDTKM
-
Molecular Weight
26.3 kDa
-
Endotoxin
< 1.0 EU per μg protein as determined by the LAL method.
-
Form
Freeze-dried powder
-
Buffer formulation
PBS, pH7.4, containing 0.01% SKL, 1mM DTT, 5% Trehalose and Proclin300.
-
Reconstitution
Reconstitute in ddH2O to a concentration of 0.1-0.5 mg/mL. Do not vortex.
- Customization
-
Stability Test
The thermal stability is described by the loss rate. The loss rate was determined by accelerated thermal degradation test, that is, incubate the protein at 37℃ for 48h, and no obvious degradation and precipitation were observed. The loss rate isless than 8% within the expiration date under appropriate storage condition.
-
Storage & Shelf Life
Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃. Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
-
Shipping
In general, recombinant proteins are supplied as lyophilized powder and shipped at ambient temperature. For bulk packages, the proteins are provided as frozen liquid and shipped with blue ice, unless otherwise requested by the customer.
Quality inspection process
Related Products
Protein Description
KCNJ1, also known as the renal outer medullary potassium channel (ROMK), is a member of the potassium ion channel family and plays a crucial role in renal physiology, particularly in potassium homeostasis and signal transduction pathways in the kidneys. Mutations in the KCNJ1 gene have been implicated in a rare genetic disorder called Bartter syndrome, characterized by hypokalemia, metabolic alkalosis, and increased renin and aldosterone levels, leading to electrolyte imbalances. The study of KCNJ1 recombinant proteins is essential for understanding the structure-function relationships of this channel, its physiological role in the nephron, and its interactions with various pharmacological agents. Additionally, KCNJ1 is a potential target for drug development aimed at treating conditions related to potassium imbalance and other renal pathologies. Research into its recombinant expression allows for detailed biophysical and biochemical characterization, which is necessary for deciphering the dynamics of ion conduction and the mechanisms underlying its regulation. Understanding how mutations affect KCNJ1 function can also provide insights into the disease mechanisms of Bartter syndrome and guide therapeutic strategies. Therefore, KCNJ1 recombinant proteins serve as a critical tool in both basic and applied research, enhancing our comprehension of kidney function and paving the way for novel treatment options for related disorders.
